www.mayflowerbio.com
Sales & Support: 314-485-5210

*

Ovine IL-6 Recombinant Protein

Supplier:
Kingfisher Biotech
Catalogue number:
RP0367V-500
Size:
500 µg (5 X 100 µg)
Product is available in:
  • USA
  • Canada
$3300.00 Shipping is calculated in checkout

The Ovine IL-6 yeast-derived recombinant protein is not tagged and is naturally endotoxin-free. The purity is greater than 98% as visualized by SDS-PAGE analysis. Ovine IL-6 applications are for cell culture, ELISA standard, and Western Blot Control. The Ovine IL-6 yeast-derived recombinant protein can be purchased in multiple sizes. Ovine IL-6 Specifications: (Molecular Weight: 20.4 kDa) (Amino Acid Sequence: GPLGEDFKNDTTPSRLLLTTPEKTEALIKHIVDKISAIRKEICEKNDECENSKETLAENKLKLPKMEEKDGCFQSGFNQAICLIKTTAGLLEYQIYLDFLQNEFEGNQETVMELQSSIRTLIQILKEKIAGLITTPATHTDMLEKMQSSNEWVKNAKVIIILRSLENFLQFSLRAIRMK (179)) (Gene ID: 443406). For research use only. Made in the USA

Product Type:

Peptides & proteins

Storage Temperature:

-20 C

Additional Information:

SOURCE: Yeast; PURITY: 98%; FORM: Lyophilized; 100% HOMOLOGY: Ovine