Mouse VEGF-A Recombinant Protein

The Mouse VEGF-A yeast-derived recombinant protein is not tagged and is naturally endotoxin-free. The purity is greater than 98% as visualized by SDS-PAGE analysis. Mouse VEGF-A applications are for cell culture, ELISA standard, and Western Blot Control. The Mouse VEGF-A yeast-derived recombinant protein can be purchased in multiple sizes. Mouse VEGF-A Specifications: (Molecular Weight: 19.3 kDa) (Amino Acid Sequence: APTTEGEQKSHEVIKFMDVYQRSYCRPIETLVDIFQEYPDEIEYIFKPSCVPLMRCAGCCNDEALECVPTSESNITMQIMRIKPHQSQHIGEMSFLQHSRCECRPKKDRTKPENHCEPCSERRKHLFVQDPQTCKCSCKNTDSRCKARQLELNERTCRCDKPRR (164)) (Gene ID: 22339). For research use only. Made in the USA