www.mayflowerbio.com
Sales & Support: 314-485-5210

*

Mouse APRIL Recombinant Protein

Supplier:
Kingfisher Biotech
Catalogue number:
RP0360M-100
Size:
100 µg
Product is available in:
  • USA
  • Canada
$900.00 Shipping is calculated in checkout

The Mouse APRIL yeast-derived recombinant protein is not tagged and is naturally endotoxin-free. The purity is greater than 98% as visualized by SDS-PAGE analysis. Mouse APRIL applications are for cell culture, ELISA standard, and Western Blot Control. The Mouse APRIL yeast-derived recombinant protein can be purchased in multiple sizes. Mouse APRIL Specifications: (Molecular Weight: 16.4 kDa) (Amino Acid Sequence: AVLTQKHKKKHSVLHLVPVNITSKADSDVTEVMWQPVLRRGRGLEAQGDIVRVWDTGIYLLYSQVLFHDVTFTMGQVVSREGQGRRETLFRCIRSMPSDPDRAYNSCYSAGVFHLHQGDIITVKIPRANAKLSLSPHGTFLGFVKL (146)) (Gene ID: 69583). For research use only. Made in the USA

Product Type:

Peptides & proteins

Alternative Names:

TNFSF13

Storage Temperature:

-20 C

Additional Information:

SOURCE: Yeast; PURITY: 98%; FORM: Lyophilized; 100% HOMOLOGY: Mouse