www.mayflowerbio.com
Sales & Support: 314-485-5210

*

Guinea Pig CXCL1 Recombinant Protein

Supplier:
Catalogue number:
RP0363GP-500
Size:
500 µg (5 X 100 µg)
Product is available in:
  • USA
  • Canada
$3300.00 Shipping is calculated in checkout

The Guinea Pig CXCL1 yeast-derived recombinant protein is not tagged and is naturally endotoxin-free. The purity is greater than 98% as visualized by SDS-PAGE analysis. Guinea Pig CXCL1 applications are for cell culture, ELISA standard, and Western Blot Control. The Guinea Pig CXCL1 yeast-derived recombinant protein can be purchased in multiple sizes. Guinea Pig CXCL1 Specifications: (Molecular Weight: 7.8 kDa) (Amino Acid Sequence: APAASELRCRCLRPVRGLHPKNIQSVAVTAPGPHCHQTEVLATLKDGREACLDEAPMVQKVLQRMLKGSKAT (72)) (Gene ID: 100135510). For research use only. Made in the USA

Product Type:

Peptides & proteins

Alternative Names:

GRO alpha

Storage Temperature:

-20 C

Additional Information:

SOURCE: Yeast; PURITY: 98%; FORM: Lyophilized; 100% HOMOLOGY: Guinea Pig