Equine IL-17A Recombinant Protein
Supplier:
Catalogue number:
RP0078E-500
Size:
500 µg (5 X 100 µg)
Product is available in:
The Equine IL-17A yeast-derived recombinant protein is not tagged and is naturally endotoxin-free. The purity is greater than 98% as visualized by SDS-PAGE analysis. Equine IL-17A applications are for cell culture, ELISA standard, and Western Blot Control. The Equine IL-17A yeast-derived recombinant protein can be purchased in multiple sizes. Equine IL-17A Specifications: (Molecular Weight: 14.9 kDa) (Amino Acid Sequence: GIVIPQNPECPNTGDKNFPQNVKINLNVLNRKTNSRRASDYHNRSTSPWNLHRNEDPERYPSVIWEAKCRHLGCVNAEGKVDFHMNSVPIQQEILVLRRESQNCPHSFQLEKMLVAVGCTCVTPIVRHMG) (Gene ID: 100034142). For research use only. Made in the USA
Product Type:
Peptides & proteins
Storage Temperature:
-20 C
Additional Information:
SOURCE: Yeast; PURITY: 98%; FORM: Lyophilized; 100% HOMOLOGY: Equine