Bovine CCL11 Recombinant Protein
Supplier:
Kingfisher Biotech
Catalogue number:
RP0071B-500
Size:
500 µg (5 X 100 µg)
Product is available in:
The Bovine CCL11 yeast-derived recombinant protein is not tagged and is naturally endotoxin-free. The purity is greater than 98% as visualized by SDS-PAGE analysis. Bovine CCL11 applications are for cell culture, ELISA standard, and Western Blot Control. The Bovine CCL11 yeast-derived recombinant protein can be purchased in multiple sizes. Bovine CCL11 Specifications: (Molecular Weight: 8.6 kDa) (Amino Acid Sequence: QPASIPTICCFNMSKKKISIQRLQSYRKITSSKCPQKAVIFNTKQNKKICVDPQEKWVQNAMEYLNQKSQTLKS) (Gene ID: 404072). For research use only. Made in the USA
Product Type:
Peptides & proteins
Alternative Names:
Eotaxin-1
Storage Temperature:
-20 C
Additional Information:
SOURCE: Yeast; PURITY: 98%; FORM: Lyophilized; 100% HOMOLOGY: Bovine, Bison, Water Buffalo, Yak, Zebu