Bovine IL-1 alpha Recombinant Protein

The Bovine IL-1 alpha yeast-derived recombinant protein is not tagged and is naturally endotoxin-free. The purity is greater than 98% as visualized by SDS-PAGE analysis. Bovine IL-1 alpha applications are for cell culture, ELISA standard, and Western Blot Control. The Bovine IL-1 alpha yeast-derived recombinant protein can be purchased in multiple sizes. Bovine IL-1 alpha Specifications: (Molecular Weight: 17.1 kDa) (Amino Acid Sequence: SNVKYNFMRVIHQECILNDALNQSIIRDMSGPYLTATTLNNLEEAVKFDMVAYVSEEDSQLPVTLRISKTQLFVSAQNEDEPVLLKEMPETPKIIKDETNLLFFWEKHGSMDYFKSVAHPKLFIATKQEKLVHMASGPPSITDFQILEK) (Gene ID: 281250). For research use only. Made in the USA