Human Frizzled-1 Recombinant Protein

The Human Frizzled-1 yeast-derived recombinant protein is not tagged and is naturally endotoxin-free. The purity is greater than 98% as visualized by SDS-PAGE analysis. Human Frizzled-1 applications are for cell culture, ELISA standard, and Western Blot Control. Human Frizzled-1 yeast-derived recombinant protein can be purchased in multiple sizes. Human Frizzled-1 Specifications: (Molecular Weight: 19.4 kDa) (Amino Acid Sequence: QAAGQGPGQGPGPGQQPPPPPQQQQSGQQYNGERGISVPDHGYCQPISIPLCTDIAYNQTIMPNLLGHTNQEDAGLEVHQFYPLVKVQCSAELKFFLCSMYAPVCTVLEQALPPCRSLCERARQGCEALMNKFGFQWPDTLKCEKFPVHGAGELCVGQNTSDKGTPTPSLLPEFWTSN (178)) (Gene ID: 8321). For research use only. Made in the USA