Mouse Annexin V Recombinant Protein

The Mouse Annexin V yeast-derived recombinant protein is not tagged and is naturally endotoxin-free. The purity is greater than 98% as visualized by SDS-PAGE analysis. Mouse Annexin V applications are for cell culture, ELISA standard, and Western Blot Control. Mouse Annexin V yeast-derived recombinant protein can be purchased in multiple sizes. Mouse Annexin V Specifications: (Molecular Weight: 35.8 kDa) (Amino Acid Sequence: MATRGTVTDFPGFDGRADAEVLRKAMKGLGTDEDSILNLLTSRSNAQRQEIAQEFKTLFGRDLVDDLKSELTGKFEKLIVAMMKPSRLYDAYELKHALKGAGTDEKVLTEIIASRTPEELSAIKQVYEEEYGSNLEDDVVGDTSGYYQRMLVVLLQANRDPDTAIDDAQVELDAQALFQAGELKWGTDEEKFITIFGTRSVSHLRRVFDKYMTISGFQIEETIDRETSGNLEQLLLAVVKSIRSIPAYLAETLYYAMKGAGTDDHTLIRVVVSRSEIDLFNIRKEFRKNFATSLYSMIKGDTSGDYKKALLLLCGGEDD (319)) (Gene ID: 11747). For research use only. Made in the USA