Guinea Pig TGF-alpha Recombinant Protein
Supplier:
Catalogue number:
RP1657GP-025
Size:
25 µg
Product is available in:
The Guinea Pig TGF-alpha yeast-derived recombinant protein is not tagged and is naturally endotoxin-free. The purity is greater than 98% as visualized by SDS-PAGE analysis. Guinea Pig TGF-alpha applications are for cell culture, ELISA standard, and Western Blot Control. Guinea Pig TGF-alpha yeast-derived recombinant protein can be purchased in multiple sizes. Guinea Pig TGF-alpha Specifications: (Molecular Weight: 5.6 kDa) (Amino Acid Sequence: VLSHFNDCPDSHTQFCFHGTCRFLVQEDKPACVCHSGYVGARCEHADLL) (Gene ID: 102005158). For research use only. Made in the USA
Product Type:
Peptides & proteins
Storage Temperature:
-20 C
Additional Information:
SOURCE: Yeast; PURITY: 98%; FORM: Lyophilized; 100% HOMOLOGY: Guinea Pig