www.mayflowerbio.com
Sales & Support: 314-485-5210

*

Guinea Pig TGF-alpha Recombinant Protein

Supplier:
Catalogue number:
RP1657GP-005
Size:
5 µg
Product is available in:
  • USA
  • Canada
$160.00 Shipping is calculated in checkout

The Guinea Pig TGF-alpha yeast-derived recombinant protein is not tagged and is naturally endotoxin-free. The purity is greater than 98% as visualized by SDS-PAGE analysis. Guinea Pig TGF-alpha applications are for cell culture, ELISA standard, and Western Blot Control. Guinea Pig TGF-alpha yeast-derived recombinant protein can be purchased in multiple sizes. Guinea Pig TGF-alpha Specifications: (Molecular Weight: 5.6 kDa) (Amino Acid Sequence: VLSHFNDCPDSHTQFCFHGTCRFLVQEDKPACVCHSGYVGARCEHADLL) (Gene ID: 102005158). For research use only. Made in the USA

Product Type:

Peptides & proteins

Storage Temperature:

-20 C

Additional Information:

SOURCE: Yeast; PURITY: 98%; FORM: Lyophilized; 100% HOMOLOGY: Guinea Pig