www.mayflowerbio.com
Sales & Support: 314-485-5210

*

IL-19, mouse recombinant

Catalogue number:
GFM75-100
Size:
100 µg
Product is available in:
  • USA
  • Canada
$734.00 Shipping is calculated in checkout

Interleukin-19 (IL-19) is produced by resting B cells and monocytes. IL-19 can be up-regulated when monocytes are treated with GM-CSF or LPS. IL-19 shares a receptor complex with IL-20. It acts to induce IL-6 and TNF-alpha production by monocytes as well as to promote a Th2 response. Recombinant mouse IL-19 is a non-glycosylated protein, containing 153 amino acids, with a molecular weight of 17.7 kDa.

Product Type:

Peptides & proteins

Storage Temperature:

at -20°C

Shelf Life:

at least 12 months

Additional Information:

NAME: Interleukin-19; ACCESSION/UNIPROT#: Q8CJ70; EXPRESSION SYSTEM: E.coli; FORMAT: Lyophilized from a sterile (0.2 micron) filtered aqueous solution containing 10 mM sodium phosphate, 50 mM sodium chloride, pH 7.5. Reconstitute in sterile water at 0.1 mg/mL.; #AA: 153; SEQUENCE: MLRRCLISVDMRLIEKSFHEIKRAMQTKDTFKNVTILSLENLRSIKPGDVCCMTNNLLTFYRDRVFQDHQERSLEVLRRISSIANSFLCVQKSLERCQVHRQCNCSQEATNATRIIHDNYNQLEVSSAALKSLGELNILLAWIDRNHLETPAA