www.mayflowerbio.com
Sales & Support: 314-485-5210

*

Equine IL-13 Recombinant Protein

Supplier:
Catalogue number:
RP0102E-100
Size:
100 µg
Product is available in:
  • USA
  • Canada
$900.00 Shipping is calculated in checkout

The Equine IL-13 yeast-derived recombinant protein is not tagged and is naturally endotoxin-free. The purity is greater than 98% as visualized by SDS-PAGE analysis. Equine IL-13 applications are for cell culture, ELISA standard, and Western Blot Control. The Equine IL-13 yeast-derived recombinant protein can be purchased in multiple sizes. Equine IL-13 Specifications: (Molecular Weight: 12.6 kDa) (Amino Acid Sequence: SPAPLPSSMALKELIKELVNITQNQAPLCNGSMVWSVNLTADTYCRALESLSNVSTCSAIQNTRKMLTKLCPHQLSAGQVSSERARDTKIEVIVLVKDLLKNLRKIFHGGKHVDA) (Gene ID: 100034113). For research use only. Made in the USA

Product Type:

Peptides & proteins

Storage Temperature:

-20 C

Additional Information:

SOURCE: Yeast; PURITY: 98%; FORM: Lyophilized; 100% HOMOLOGY: Equine