Chicken CCL20 Recombinant Protein
Supplier:
Catalogue number:
RP0061C-005
Size:
5 µg
Product is available in:
The Chicken CCL20 yeast-derived recombinant protein is not tagged and is naturally endotoxin-free. The purity is greater than 98% as visualized by SDS-PAGE analysis. Chicken CCL20 applications are for cell culture, ELISA standard, and Western Blot Control. The Chicken CCL20 yeast-derived recombinant protein can be purchased in multiple sizes. Chicken CCL20 Specifications: (Molecular Weight: 8.3 kDa) (Amino Acid Sequence: QSNQDCCLSYSKVRLPRKVIKGFTEQLSGEVCDIDAIIFHTVRGLKACVNPKEDWVKKHLLFLSQKLKRMSM) (Gene ID: 395082). For research use only. Made in the USA
Product Type:
Peptides & proteins
Alternative Names:
LARC
Storage Temperature:
-20 C
Additional Information:
SOURCE: Yeast; PURITY: 98%; FORM: Lyophilized; 100% HOMOLOGY: Chicken