Equine CCL11 Recombinant Protein
Supplier:
Catalogue number:
RP0066E-100
Size:
100 µg
Product is available in:
The Equine CCL11 yeast-derived recombinant protein is not tagged and is naturally endotoxin-free. The purity is greater than 98% as visualized by SDS-PAGE analysis. Equine CCL11 applications are for cell culture, ELISA standard, and Western Blot Control. The Equine CCL11 yeast-derived recombinant protein can be purchased in multiple sizes. Equine CCL11 Specifications: (Molecular Weight: 9.0 kDa) (Amino Acid Sequence: AQPVSISTVCCFNVASRKISFQRLQSYRKITSSKCPQKAVIFKTKQAKKICADPKQKWVQDAMKYLDENSRTTKYSSF) (Gene ID: 100033949). For research use only. Made in the USA
Product Type:
Peptides & proteins
Alternative Names:
Eotaxin
Storage Temperature:
-20 C
Additional Information:
SOURCE: Yeast; PURITY: 98%; FORM: Lyophilized; 100% HOMOLOGY: Equine