Rat APRIL Recombinant Protein

The Rat APRIL yeast-derived recombinant protein is not tagged and is naturally endotoxin-free. The purity is greater than 98% as visualized by SDS-PAGE analysis. Rat APRIL applications are for cell culture, ELISA standard, and Western Blot Control. The Rat APRIL yeast-derived recombinant protein can be purchased in multiple sizes. Rat APRIL Specifications: (Molecular Weight: 16.4 kDa) (Amino Acid Sequence: AVLTQKHKKKQSVLHLVPINITSKADSDMTEVMWQPALRRGRGLEAQGDTVRVRDTGIYLLYSQVLFHDVTFTMGQVVSREGQGRRETLFRCIKSMPSDPDRAYNSCYSAGVFHLHQGDIITVKIPRANAKLSLSPHGTFLGFVKL (146)) (Gene ID: 287437). For research use only. Made in the USA