Cycloviolacin O2
Cycloviolacin O2 peptide (CyO2) is a cyclotide isolated from Viola odorata. Cyclotides are circular peptides with remarkable characteristics including a head-to-tail cyclized backbone and 6 cysteine residues forming cyclic-cystine-knot motif (CCK) by three disulfide bonds. Cyclotides show potent cytotoxic activity that’s why they represent novel range of cytotoxic agents. Cycloviolacin O2 has antitumor effect and specific membrane-disrupting activity resulting in cell death and appears to be selective to tumoral cells. CyO2 has also demonstrated a potent bactericidal activity against Gram – bacteria with a MIC of 2.2µM on E. coli. Cycloviolacin O2 provides a potential scaffold for future drug design. Cycloviolacin O2 peptide is a head-to-tail cyclic peptide with three disulfide bridges between 1-4, 2-5 and 3-6.
Peptides & proteins
CATEGORY: Antimicrobial peptides - AMP; SEQUENCE: GIPCGESCVWIPCISSAIGCSCKSKVCYRN