www.mayflowerbio.com
Sales & Support: 314-485-5210

*

Dc1a

Catalogue number:
DCA001-01000
Size:
1000 µg
Product is available in:
  • USA
  • Canada
$3153.00 Shipping is calculated in checkout

Dc1a is an insecticidal peptide. β-Diguetoxin-Dc1a (Dc1a) is a peptide which has been isolated from the desert bush spider Diguetia canities. Dc1a has demonstrated insecticidal properties by promoting the opening of German cockroach voltage-gated sodium (Nav) channels (BgNav1) without affecting human Nav channels.

Product Type:

Peptides & proteins

Reference:

Bende N., et al. (2015) A distinct sodium channel voltage-sensor locus determines insect selectivity of the spider toxin Dc1a. Nat Commun. PMID: 25014760

Additional Information:

AA Sequence: AKDGDVEGPAGCKKYDVECDSGECCQKQYLWYKWRPLDCRCLKSGFFSSKCVCRDV. Disulfide bonds between Cys12-Cys25, Cys19-Cys39 and Cys24-Cys55

Related Content: