Canine IL-1 beta Biotinylated Recombinant Protein

The Canine IL-1 beta Biotinylated yeast-derived recombinant protein is not tagged and is naturally endotoxin-free. The purity is greater than 98% as visualized by SDS-PAGE analysis. Canine IL-1 beta Biotinylated applications are for cell culture. Canine IL-1 beta Biotinylated yeast-derived recombinant protein can be purchased in multiple sizes. Canine IL-1 beta Biotinylated Specifications: (Molecular Weight: 17.5 kDa) (Amino Acid Sequence: AAMQSVDCKLQDISHKYLVLSNSYELRALHLNGENVNKQVVFHMSFVHGDESNNKIPVVLGIKQKNLYLSCVMKDGKPTLQLEKVDPKVYPKRKMEKRFVFNKIEIKNTVEFESSQYPNWYISTSQVEGMPVFLGNTRGGQDITDFTMEFSS) (Gene ID: 403974). For research use only. Made in the USA