www.mayflowerbio.com
Sales & Support: 314-485-5210

*

Rabbit CTLA-4 Recombinant Protein

Supplier:
Kingfisher Biotech
Catalogue number:
RP1858U-025
Size:
25 µg
Product is available in:
  • USA
  • Canada
$320.00 Shipping is calculated in checkout

The Rabbit sCTLA-4 yeast-derived recombinant protein is not tagged and is naturally endotoxin-free. The purity is greater than 98% as visualized by SDS-PAGE analysis Rabbit sCTLA-4 applications are for cell culture, ELISA standard, and Western Blot Control. Rabbit sCTLA-4 yeast-derived recombinant protein can be purchased in multiple sizes. Rabbit sCTLA-4 Specifications: (Molecular Weight: 13.5 kDa) (Amino Acid Sequence: LHVSQPAVVLASSRGVASFVCEYASSHKATEVRVTVLRQANSQMTEVCAMTYTVENELTFIDDSTCTGISHGNKVNLTIQGLSAMDTGLYICKVELMYPPPYYVGMGNGTQIYVIEPEPCPDSD (124)) (Gene ID: 100009412). For research use only. Made in the USA

Product Type:

Peptides & proteins

Storage Temperature:

-20 C

Additional Information:

SOURCE: Yeast; PURITY: 98%; FORM: Lyophilized; 100% HOMOLOGY: Rabbit